Pembinavalleyonline funeral announcements. Arrangements by Wiebe Funeral Home, Winkler.
Pembinavalleyonline funeral announcements She is survived by her nieces and nephews. The funeral service for Art Dyck will be held Saturday, February 15th at 1:30pm at Altona Bergthaler Mennonite Church with private family Jan 13, 2025 · Funeral For: Francis Giesbrecht Funeral Date: January 15, 2025 Francis Giesbrecht, 82, of Winkler formerly of Rosengart passed away Friday, January10th at his residence. The celebration of life for Susan Rempel nee Derksen will be held Friday Dec 21, 2024 · Funeral For: Mary Friesen Funeral Date: December 23, 2024 Mary Friesen, 102, of Winkler formerly of Rosenfeld, passed away Thursday, December 19th at Salem Home. He is survived by his wife Anne, parents Harold and Helen Hamm, 1 sister and her family. He is survived by 5 daughters, 2 sons, 1 sister-in-law, and their families. He is survived by 2 sisters, 3 brothers and their families, He was predeceased by his parents. She was predeceased by her husband Abram, and 2 brothers. Arrangements by Morris Funeral Home. The funeral service for Martha Dueck will be held Sunday, March 10th at 3pm at Eastview Community Church, 315 Maxwell King Drive, East St. Arrangements by Sneath-Strilchuk Funeral Services, Dauphin. Doerr, 89, of Winnipeg passed away Tuesday, March 4th at Seven Oaks Hospital. The funeral service for Gerald Lemay will be held Tuesday, January 21st at 11am at Birchwood Funeral Chapel with burial at Jan 4, 2025 · Funeral For: Abram Wiebe Funeral Date: January 9, 2025 Abram Wiebe, 89, of Winnipeg passed away Saturday, December 28th at Bethania Mennonite Personal Care Home. She is survived by 4 sons. He was predeceased by 4 sisters and 3 brothers. He is survived by his wife Anne, 2 daughters, 2 sons, and their families. Wiens Funeral Date: December 19, 2024 Peter P. He was predeceased by 1 brother and 3 brothers-in-law. Betty Harder. Viewing will be Sep 3, 2018 · Funeral For: Bernhard Krahn Funeral Date: September 7, 2018 Bernhard Krahn, 86, of Winkler formerly of Miami, passed away Saturday, September 1st at Boundary Trails Health Centre. The funeral service for Francis Giesbrecht will be held Wednesday, January 15th at 2pm at Winkler Bergthaler Mennonite Church with burial at Westridge Feb 17, 2025 · Memorial Service For: Helena Wiebe nee Friesen Memorial Service Date: February 21, 2025 Helena Wiebe nee Friesen, 99, of Manitou formerly of Morden, passed away Tuesday, February 11th at Pembina-Manitou Health Centre. Helen Harder, 94, of Winkler formerly of Plum Coulee passed away Monday, September 23rd at Salem Home. She was predeceased by her husband Henry J. Jan 8, 2025 · Funeral For: Elvira Harder nee Toews Funeral Date: January 11, 2025 Elvira Harder nee Toews, 85, of Altona passed away Sunday, January 5th at Boundary Trails Health Centre. He was predeceased by his wife Linda. A memorial service for Pastor Jake Harms will be held Tuesday, March 25th, 2pm at Douglas Mennonite Church in Winnipeg. Arrangements Sep 8, 2021 · Funeral For: Bill Unger Funeral Date: September 11, 2021 Bill Unger, 73, of Austin passed away Monday, September 6th at Carberry Plains Health Centre. He was predeceased by his first wife Mary, second wife Ella, 1 daughter and 1 grandson. The funeral service for Reinhold Heinrich Pauls will be held Monday, February 24th at 11am at North Dec 23, 2024 · Funeral For: Nelson Norris Funeral Date: At a later date Nelson Norris, 69, of Morris passed away Thursday, December 19th at Boundary Trails Health Centre. She was predeceased by her husband Francis. Browse by city, date, name, or funeral home and view the most recent obituaries published on the Web. He was predeceased by 1 sister in infancy, 3 brothers, and 1 great-grandson. The funeral service for Peter Hildebrand will be held Sunday, January 23 at 3pm by Feb 22, 2025 · Funeral For: Leona Enns Funeral Date: February 26, 2025 Leona Enns, 88, of Grunthal passed away Wednesday, February 19th at Bethesda Regional Health Centre. The funeral service for Anna Neufeld will be held Monday, 10am at Springfield Heights Mennonite Church, 570 Sharron Bay, with Mar 8, 2024 · Funeral For: Martha Dueck Funeral Date: March 10, 2024 Martha Dueck, 72, of East St. A memorial service for Helena Wiebe nee Friesen will be held Friday, February 21st at 2pm at Christian Mar 4, 2025 · Funeral For: Eva Friesen Funeral Date: Private Eva Friesen, 79, of Altona passed away Saturday, March 1st at Eastview Place. Viewing will be at Doyle’s Funeral Home Thursday Nov 17, 2024 · Celebration of Life For: Leo Braun Celebration of Life Date: November 20, 2024 Leo Braun, 79, of Niverville formerly of Blumenort, passed away Wednesday, November 13th at DeSalaberry District Health Centre. He was predeceased by 1 son, 3 sisters, and 3 brothers. He was predeceased by 2 daughters. The funeral service for Henry Thiessen will be held Saturday, January 4th at 11am at Birchwood Funeral Chapel with burial at Stuartburn Sommerfeld Cemetery. Viewing will Dec 11, 2024 · Funeral For: Rita Florence Reimer Funeral Date: December 13, 2024 Rita Florence Reimer, 54, of Blumenort passed away Monday, December 9th at Bethesda Regional Health Centre. She was predeceased by her husband Abram W. Friesen. com - Local news, Weather, Sports, Free Classifieds and Business Listings for the Pembina Valley, Manitoba Mar 5, 2025 · Search obituaries and death notices from Winkler, Manitoba, brought to you by Echovita. Joe will be lovingly remembered by his wife and soulmate of 37 years, Rachel, son Joshua (Jessica) and their daughters Jenessa and Jordyn, son Brandon and his boys Waylon and Ruston. Helen Braun nee Toews. Burial will take place at Westridge Memorial Gardens. He was predeceased by his wife Olly. The funeral service for Hazel Gerbrandt will be held Saturday, January 4th at 11am at Crestview Fellowship, 271 Hamilton Avenue Dec 2, 2024 · Funeral For: Robert Bob Siemens Funeral Date: December 5, 2024 Robert Bob Siemens, 64, of Winnipeg passed away Wednesday, November 27th at Winnipeg. He is lovingly remembered by his wife Pat, sons Jeffrey (Jessica), Grant (Leanne), daughter-in-law Sarah, and their families. The funeral service for Elma Fuhr will be held Saturday, October 31st at 2pm at Dauphin Grace Bible Church with interment at Ochre River Cemetery. A memorial service for Abram Wiebe will be held Thursday, January 9th at 1pm at North Kildonan Mennonite Dec 24, 2024 · Memorial Service For: Della Fast Memorial Date: December 29, 2024 Della Fast, 100, of Steinbach passed away Monday, December 23rd at Bethesda Regional Health Centre. He was predeceased by his father Peter Fast and his stepfather Frank Falk. She is survived by 1 daughter, 3 sons, and their families. She was predeceased by her husband Peter, 1 sister, and 3 brothers. He is survived by his wife Margaret, 4 daughters, 8 sons and their families. Grieving doesn't always end with the funeral. ← Previous Nov 4, 2024 · Funeral For: Mary Siemens nee Letkeman Funeral Date: November 6, 2024 Mary Siemens nee Letkeman, 98, of Altona formerly of Rosenfeld, passed away Monday, October 28th at Eastview Place. You can also send flowers or thoughtful gifts to commemorate your loved ones. Toews. He was predeceased by his son Darin. She is survived by 2 daughters and 1 son. He is also survived by older brother Arvind, and many Nov 2, 2024 · Funeral For: Viola Friesen nee Fuchs Funeral Date: November 5, 2024 Viola Friesen nee Fuchs, 89, of Emerson formerly of Steinbach, passed away Thursday, October 31st at Emerson Personal Care Home. Cornelious Jacob Giesbrecht. She is survived by her husband Waldo, 1 daughter, 1 son, 4 sisters, 2 brothers, 1 sister-in-law, and their families. Jan 1, 2025 · The funeral service for Tina Thiessen nee Unger will be held Saturday, January 4th at 2pm at Chortitz Old Colony Mennonite Church with burial at Chortitz Community Cemetery. Nov 13, 2024 · Funeral For: Wes Sawatsky Funeral Date: November 16, 2024 Wes Sawatsky, 90, of Altona passed away Monday, November 11th at Boundary Trails Health Centre. A memorial service for Leonora Wiebe will be held Friday, February 28th at 11am at North Kildonan Mennonite Church, 1131 Roch Street, with ash interment at Mar 9, 2025 · Funeral For: Brett Lesley Cumberbatch Brett Lesley Cumberbatch, 41, of Winnipeg formerly of Dallas, Texas passed away Sunday, March 2nd at Winnipeg. Siemens, daughter Theresa, 2 sisters, and 3 brothers. She is survived by 4 daughters and their families. He is survived by his wife Barbara. Private interment will be held at Altona Cemetery at a later date. She was predeceased by her husband Peter, 1 son, and 1 grandson. Viewing will be at Wiebe Funeral Home, Winkler Monday, January 20th from 1 to 8pm. Viewing will be at Wiebe Funeral Home, Altona Wednesday, March Mar 6, 2025 · Funeral For: Peter Kauenhofen Funeral Date: Private Peter Kauenhofen, 86, of Winkler formerly of Roland, passed away Wednesday, March 5th at Boundary Trails Health Centre. She is survived by her husband Allan, 2 daughters, 1 sister, and 1 brother. The funeral service for Heinrich Wiebe will be held Wednesday, January 22, 2pm at Reinland Mennonite Feb 21, 2024 · Funeral For: Elizabeth “Betty” Thiessen Funeral Date: March 2, 2024 Elizabeth “Betty” Thiessen, 89, of Steinbach passed away Monday, February 19th at Bethesda Hospital. She is survived by her husband Vic, 3 sons, and their families. Hoeppner will held Wednesday, February 2nd at 1pm at Winkler EMMC burial prior to the service at Dec 19, 2024 · Funeral For: James Lohr Funeral Date: December 21, 2024 James Lohr, 88, of Steinbach passed away Tuesday, December 17th at Rest Haven Care Home. Also left to mourn his passing are his siblings Arlene (Duane), Reynald (Vanessa), Bev (Kelly), Lyle (Sandie Feb 13, 2025 · Funeral For: Helen Wolfe Funeral Date: February 16, 2025 Helen Wolfe, 92, of Winkler passed away Wednesday, February 12th at Silver Linings/Buhler Active Living Centre. The funeral service for John Schulz will be held Saturday, February 1st at 11am at Friends Community Church, Carman with burial at Bloomfield Rosewell Cemetery. She is survived by 3 daughters, 2 sons, and their families. A celebration of life for Helen Dyck will be held in spring of 2025 at the Jan 22, 2022 · Funeral for: Peter Hildebrand Funeral Date: January 23, 2022 Peter Hildebrand of Winnipeg formerly of Boissevain, passed away Tuesday, January 18th at Donwood Manor. The funeral service for Virginia Mae Blatz will be held Monday, December 9th at 2pm at Morris Multiplex Oct 31, 2024 · Funeral For: Peter Wesley Nikkel Funeral Date: November 4, 2024 Peter Wesley Nikkel, 83, of White Rock, BC formerly of Elm Creek and Winnipeg, passed away Saturday, October 19th at White Rock Hospice Centre. He is survived by his wife Shelley, 2 daughters, 2 sisters and their families. She was predeceased by her husband Dick T. He is survived by his wife Linda, 4 daughters, and their families. He is survived by 1 sister, 1 brother, and their families. He is survived by his wife Helen. A celebration of life service for Henry Rempel will be held Friday, October Nov 14, 2024 · Funeral For: Katharina Tina Toews nee Dueck Funeral Date: At a later date Katharina Tina Toews nee Dueck, 100, of Altona formerly of New Hope, passed away Wednesday, November 13th at Eastview Place. Arrangements by Birchwood Funeral Chapel, Steinbach. The funeral service for Elsie Neufeld will be held Friday, December 27th at 11am at Friends Funeral Service, 2146 Main Feb 15, 2025 · Funeral For: Leonora Wiebe Funeral Date: February 28, 2025 Leonora Wiebe, 85, of Winnipeg passed away Friday, January 30th at Winnipeg. Discover detailed obituaries, access complete funeral service information, and express your feelings by leaving condolence messages. Mar 13, 2024 · A funeral mass and celebration of Guy’s life will be held on Friday March 22nd, 2024 at 11:00am at St. He is survived by his wife Anna, 3 daughters, 1 son, 5 sisters, 3 brothers, and their families. A private funeral service for Eva Friesen will be held with burial at Blumenthal Cemetery. Rose and McCreary, Manitoba, a professional, licensed funeral director is available 24 hours a day, seven days a week. The funeral service for Cameron Bartel will be held Tuesday, October 8th at 2pm at Rosenort EMC with private family burial prior to the service at the church cemetery Jul 18, 2022 · Funeral For: Tim Epp Funeral Date: July 23, 2022 Tim Epp, 51, of Winnipeg passed away Saturday, July 16th at Grace Hospital. Paul passed away at St. A memorial service for Peter Rempel will be held Sunday, January 12th at 3pm at Birchwood Funeral Chapel with ash interment at Memorial Cemetery at a later date Dec 24, 2024 · Funeral For: Joseph Timothy Blair Funeral Date: December 28, 2024 Joseph Timothy Blair, 67, of Rosa passed away Tuesday, December 17th at Health Sciences Centre, Winnipeg. She was predeceased by 1 sister and 1 grandson. Hoeppner Memorial service Date: February 2, 2022 Isaac F. The Private Memorial Service for Isaac F. The funeral service for Roberta Fehr will be held Monday, December 2nd at 2pm at Lowe Farm Bergthaler Church with burial at Lowe Nov 25, 2024 · Funeral For: Arthur Sommerfeld Funeral Date: November 26, 2024 Arthur Sommerfeld, 90, of Whitemouth, Manitoba passed away Tuesday, November 19th in the RM of Whitemouth. A memorial service for Nelson Norris will be held at a later date. The funeral service for Bill Unger will be held Saturday, September 11th at 2pm at Gladstone Christian Mar 8, 2024 · Funeral For: Peter Doerksen Funeral Date: March 12, 2024 Peter Doerksen, 94, of Winnipeg passed away Monday, March 4th at Victoria Hospital. She is survived by 2 daughters, 1 son, and their families. Boniface Hospital. He is survived by his wife Dorothy, 2 daughters, 3 sons and their families. The funeral service for Bernhard Krahn will be held Friday, September 7th at 2:30pm at Winkler Grace Mennonite Mar 12, 2024 · Funeral For: Anna Neufeld Funeral Date: March 18, 2024 Anna Neufeld, 82, of Winnipeg passed away Sunday, March 10th at Riverview Health Centre. He is survived by his wife Anne, 1 daughter, 1 son, and their families. She was predeceased by her husband George, 1 daughter-in-law, and 1 granddaughter. A private funeral service for George Petkau Nov 9, 2024 · ERICA SOMMER Aug. He was predeceased by his wife Helen, 1 daughter, 1 son-in-law, and 1 grandson. Viewing will be held at Wiebe Funeral Home, Altona Jul 25, 2023 · Funeral For: Pamela May Funk nee Enns Funeral Date: July 28, 2023 Pamela May Funk nee Enns, 65, of Tinker Creek passed away Saturday, July 22nd at Boundary Trails Health Centre. He was predeceased by his first wife Mildred, 1 son, 1 grandson, 1 sister, and 1 brother. Pierre Hospital. She is survived by 2 daughters, 2 sons, 1 sister-in-law and their families. The celebration of life for Wes Sawatsky will be held Saturday, November 16th at 1pm at Seeds Church, Altona with private Jan 10, 2025 · Funeral For: Susan Sawatzky nee Elias Funeral Date: Spring 2025 Susan Sawatzky nee Elias, 72, of Red Deer, Alberta formerly of Morden, passed away Wednesday, January 1st at Red Deer Regional Hospital. He was predeceased by his wife Dorothy. A memorial service for Vern Wieler will be held Monday, March 17th at 2pm at Bethel Bergthaler Mennonite Church, Hochfeld with burial prior to the service at Feb 13, 2025 · Funeral For: Art Dyck Funeral Date: February 15, 2025 Art Dyck, 94, of Altona passed away Tuesday, February 11th at Altona Memorial Health Centre. A memorial service for Brian Shewchuk will be held at a later date. A celebration of life for John Falk will be held Monday, February Jan 7, 2025 · Funeral For: Willi Doerksen Funeral Date: January 11, 2025 Willi Doerksen, 61, of New Bothwell passed away Saturday, December 28th in the RM of Hanover. He is survived by his wife Jeanene, 3 sons, 1 sister, 1 brother, and their families. He was predeceased by his parents Gerhard and Aganetha Doerksen and 3 sisters. Latest in Funeral Announcements Peter Wesley Nikkel Dec 3, 2024 · Funeral For: Margaret Friesen Funeral Date: December 6, 2024 Margaret Friesen, 97, of Winnipeg passed away Sunday, December 1st at Victoria Hospital. She was predeceased by her husband John Howard Enns, 1 sister, and 2 brothers. She is survived by 1 sister and her family. Enns, 95, of Steinbach passed away Tuesday, November 26th at Bethesda Regional Health Centre. She is survived by 3 daughters, 1 son, and their families. A memorial service for Peter Wesley Nikkel will be held Monday Nov 28, 2024 · Funeral For: Roberta Fehr Funeral Date: December 2, 2024 Roberta Fehr, 84, of Lowe Farm formerly of Morris, passed away Monday, November 25th at Grace Hospital, Winnipeg. The celebration of life for Elizabeth “Betty” Thiessen will be held Saturday, March 2nd at 4pm at Jan 30, 2025 · Funeral For: John Falk Funeral Date: February 3, 2025 John Falk, 67, of Niverville passed away Tuesday, January 28th at Bethesda Regional Health Centre. Cremation has taken place. Plan a Beautiful Tribute Anywhere with Our Online Funeral Services. He is survived by his wife Helena, 2 sons, and 1 daughter-in-law. She is survived by her husband Peter, 3 daughters, 1 son, and their families. He is survived by his wife Katharine, 1 daughter, 1 son, and their families. She is survived by 2 daughters, 1 son, 1 sister, and their families. She was predeceased by her parents Peter and Susie Elias, 1 sister and 2 Dec 24, 2024 · Funeral For: Elsie Neufeld Funeral Date: December 27, 2024 Elsie Neufeld, 93, of Winnipeg passed away Sunday, December 22nd at Riverview Health Centre. Get Answers to Common Questions When You Need Them Most. Left to mourn his heart-breaking absence is his loving wife Cindy (Zacharias) Hildebrand, sister Jolane (Harv) Klippenstein, brothers Reg (Linda) Hildebrand, Glenn Hildebrand, Norm (Michele) Hildebrand, mother-in-law Mary Zacharias, sister-in-law Sandra (Jeff) Funk, brother-in-law Vern (Lisa Mar 10, 2025 · Funeral For: Susan Giesbrecht nee Schroeder Funeral Date: March 11, 2025 Susan Giesbrecht nee Schroeder, 96, of Altona passed away Friday, March 7th at Boundary Trails Health Centre. She is survived by 1 sister-in-law and numerous nieces and nephews. She was predeceased by her husband Peter and 2 sons. The funeral service for Peter Doerksen will be held Tuesday, March 12th at 2pm at Fort Garry Oct 29, 2015 · Funeral For: Elma Fuhr, Funeral Date: October 31, 2015, Elma Fuhr, 79, of Ochre River passed away Monday, October 26th. She is survived by her siblings, many nieces, nephews and their families. The funeral service for Jean Lewis will be held Wednesday, March 5th at 2pm at Morris United Church with private inurnment Nov 29, 2024 · Funeral For: Abraham H. Find obituaries for area Pembina Valley in Manitoba, Canada. He was predeceased by his first wife Marge. PembinaValleyOnline. With funeral homes in Roblin, Dauphin, Ste. A celebration of life service for Victor Penner will be held in Spring. She was predeceased by 3 sisters and 6 brothers. The funeral service for George Bartsch will be held Friday, November 15th at 1pm at Clarke’s Jan 28, 2025 · Funeral For: Betty Harder Funeral Date: January 31, 2025 Betty Harder, 70, of Niverville passed away Saturday, January 25th at DeSalaberry District Health Centre. She was predeceased by 4 sisters and 2 brothers. A public prayer service for Arthur Sommerfeld will be held Dec 13, 2024 · Funeral For: Maria Enns Funeral Date: December 18, 2024 Maria Enns, 91, of Niverville passed away Tuesday, December 10th at Heritage Life Personal Care Home. He was predeceased by 2 sisters, 3 brothers, and 1 great-grandson. The funeral service for Tim Epp will be held Saturday, July 23rd at 11am at Eastview Community Church, 135 Maxwell King Drive, with burial at Rosenfeld Jan 29, 2022 · Memorial Service for: Isaac F. He is survived by his wife Annie, 1 daughter, and her family. She was predeceased by her husband Peter. Erica was predeceased by her husband Feb 2, 2024 · Funeral For: Abram H. He is survived by his wife, 2 daughters, 1 son, and their families. The funeral service for Mary Friesen will be held Monday, December 23rd at 1pm at Wiebe Funeral Home Nov 28, 2024 · Funeral For: Walter Saarela Funeral Date: November 29, 2024 Walter Saarela, 87, of Morden passed away Saturday, November 23rd at Tabor Home. Siemens. She is survived by 2 daughters, 2 sons, and their families. She is survived by her parents Dulaney and Vicky Blatz, 1 sister, 3 brothers, and their families. He is survived by his wife Anne, 1 daughter, 3 sons, 5 inherited children and their families. He is survived by his wife Colleen, 1 daughter, 2 sons, his parents John and Sharon Epp, 1 sister, and 2 brothers. A celebration of life and ash interment for Eva Fehr will take Jan 11, 2024 · Funeral For: Cornelius Peters Funeral Date: January 13, 2024 Cornelius Peters, 87, of Winnipeg formerly of Gretna, passed away Wednesday, January 3rd at Victoria Hospital. He is survived by his wife Irene, 1 daughter, 1 son and their families, and his mother Margaret Dyck. Viewing will be at Feb 22, 2024 · Mass of Resurrection For: Marcel Collette Mass of Resurrection Date: February 24, 2024 Marcel Collette, 96, of St. She is survived by her husband Wilbert, her mother, 1 daughter, 1 son, 2 sisters, 3 brothers and their families. He is survived by his wife Connie, 1 daughter, 1 son, 4 brothers, and their families. A celebration of life for Elvira Harder nee Toews will be held Saturday, January 11th at 2pm at Rhineland Pioneer Dec 31, 2024 · Funeral For: Hazel Gerbrandt Funeral Date: January 4, 2025 Hazel Gerbrandt, 85, of Winnipeg passed away Saturday, December 28th at her residence. He was predeceased by 7 sisters, 3 brothers, 1 sister-in-law, 5 brothers-in-law, and 1 grandson. The funeral service for Margaret Friesen will be held Friday, December 6th at 11am at Schoenfelder Mennonite Church at Pigeon Feb 27, 2024 · Funeral For: Helen Cecile Fostey Funeral Date: None Helen Cecile Fostey, 77, of Sprague passed away Sunday, February 25th at Vita Hospital. She was predeceased by 4 siblings. Our staff of dedicated professionals will assist you in making arrangements that truly honour the life of you and your loved ones. He is survived by his wife Jean, 6 children, 3 stepsons, and their families. He was predeceased by his son David Wesley. Malo passed away Saturday, February 17th at Rest Haven Personal Care Home. He is survived by his wife Mary, 2 daughters, and 1 son-in-law. He is survived by 2 sons and their families. The celebration of life for Leo Braun will take place Wednesday, November 20th at 2pm at Dec 21, 2024 · Funeral For: Eva Fehr Funeral Date: At a later date Eva Fehr, 89, of Selkirk formerly of Garson, passed away Wednesday, December 18th at Selkirk Regional Health Centre. She was predeceased by her husband John. She was predeceased by her husband Peter D. Joachim Roman Catholic Church, La Broquerie Manitoba. The funeral service for Pedro “Peter” Fehr will be held Wednesday, September 22nd at 2pm Dec 2, 2024 · Funeral For: Virginia Mae Blatz Funeral Date: December 9, 2024 Virginia Mae Blatz, 23, of Morris formerly of Lowe Farm, passed away Wednesday, November 27th at Boundary Trails Health Centre. Donations may be made to Siloam Mission. Never Miss a Detail with Our Comprehensive Planning Checklist. He was predeceased by 1 daughter and 1 son. Viewing will Feb 21, 2025 · Funeral For: Reinhold Heinrich Pauls Funeral Date: February 24, 2025 Reinhold Heinrich Pauls, 63, of Winnipeg passed away Friday, February 14th at St. He is survived by his wife Leonora, 2 daughters, 1 son, and their families. The funeral service for Walter Saarela will be held Friday, November 29th at 2pm at Royal Jan 9, 2025 · Funeral For: Peter Rempel Funeral Date: January 12, 2024 Peter Rempel, 81, of Steinbach passed away Saturday, January 4th at his residence. He is survived by his wife Gerda, 2 daughters, 3 sons, 1 brother, and their families. She is survived by 1 daughter, 5 sons, and their families. She is survived by 2 daughters, 4 grandchildren, and 6 great-grandchildren. Enns will be held Monday, December 2nd at 11am at Sep 25, 2024 · Funeral For: Helen Harder Funeral Date: Private family graveside service at a later date. She was predeceased by 1 daughter and 1 son. She is survived by 1 daughter, 1 son, and their families. Viewing Dec 3, 2024 · Funeral For: Helen Dyck Funeral Date: Spring 2025 Helen Dyck, 94, of Steinbach formerly of Arnaud, passed away Saturday, November 30th at Bethesda Regional Health Centre. She is survived by her stepchildren, 3 sisters, 1 brother and their families. He was predeceased by his parents and 2 brothers. The funeral service for Pamela May Funk nee Enns will be held Friday, July 28th at 2pm at Wiebe Nov 7, 2024 · Funeral For: Henry Rempel Funeral Date: November 11, 2025 Henry Rempel, 91, of Killarney formerly of Niverville, passed away Tuesday, November 5th at St. He is survived by his wife Celina, Celina, son Jeremy, daughter Carly, stepson Callum, stepdaughter Keely, and granddaughter Reaven. A memorial service for Della Fast will be held Sunday, December 29th at 2pm at Birchwood Funeral Chapel. The celebration of life for Mary Siemens nee Letkeman will be held Wednesday, November 6th at 2pm Oct 30, 2024 · Memorial For: Bernhard “Ben” Falk Memorial Date: Private Bernhard “Ben” Falk, 76, of Altona passed away Saturday, October 26th at Altona Memorial Health Centre. John’s Roman Catholic Church, Morden with Mar 1, 2025 · Funeral For: Jean Lewis Funeral Date: March 5, 2025 Jean Lewis, 94, of Winnipeg formerly of Morris, passed away Sunday, February 23rd at Holy Family Home. The celebration of life for Susan Giesbrecht nee Schroeder will be held Tuesday, March 11th Feb 9, 2024 · Funeral For: Mary Fehr nee Dyck Funeral Date: February 13, 2024 Mary Fehr nee Dyck, 77, of Altona passed away Wednesday, February 7th at her residence. He was predeceased by 1 sister and 1 brother. The funeral service for Esther Paetkau will be held Monday, November 18th at 2pm at Morris Emmanuel Baptist Church with private family burial prior to Mar 10, 2025 · Funeral For: Alice Ostrowsky Funeral Date: March 12, 2025 Alice Ostrowsky, 84, of Vita formerly of Rosa, passed away Wednesday, March 5th at Vita Personal Care Home. He was predeceased by 2 sons. Erica is survived by daughters, Lisa (Jon), Krista (Chris), and Rachel (Stuart); and grandchildren, Noah, Heath, Piper, and Finn. He was predeceased by his parents Steve and Mary Shewchuk and in-laws Frances and Becky Anderson. She is survived by 2 sons, 1 son-in-law, and their families. She was predeceased by her husband Henry. He was predeceased by his first wife Maryanne, second wife Elma, and all of his siblings. The funeral service for Rita Florence Reimer will be held Friday, December 13th at 2pm at Blumenort Community Church with burial at the church Nov 15, 2024 · Funeral For: George Bartsch Funeral Date: November 15, 2024 George Bartsch, 92, of Gladstone formerly of Austin and McCreary, passed away Monday, November 11th at Gladstone. A memorial service for Vern Wiens will be held Sunday, December 22nd at 2pm at Glenlea Mennonite Church, 1012 Glenlea Road, with ash interment at the Nov 14, 2024 · Funeral For: Esther Paetkau Funeral Date: November 18, 2024 Esther Paetkau, 76, of Winkler formerly of Morris, passed away Tuesday, November 12th at Boundary Trails Health Centre. Donations may be made to Mennonite Central Jun 29, 2018 · Memorial For: Brian Shewchuk Memorial Date: at a later date Brian Shewchuk, 71, of Morris formerly of Lowe Farm, passed away Monday, June 25th at Morris Hospital. The funeral service for Maria Enns will be held Wednesday, December 18th at 11am at Dec 6, 2024 · Funeral For: Minna Loewen Funeral Date: December 9, 2024 Minna Loewen, 100, of Steinbach passed away Tuesday, December 3rd at Rest Haven Nursing Home. com. Mass of Resurrection for Sheila Paulette Mary Campbell will be held Wednesday, August 28th at 10am at St. He was predeceased by 6 grandchildren. He is survived by his wife Ella, 1 daughter, 2 sons, 1-son-in-law, and their families. He is survived by his wife Wilma, 2 daughters, 2 sons, 2 sisters, 2 brothers, and their families. He was predeceased by his wife Marianne. She is survived by 2 daughters, 3 sons, and their families. A memorial service for Mary Zacharias will be held Friday, January 31st at 2pm at Wiebe Funeral Chapel, Morden with burial prior to the service at 1pm at Rosenbach Cemetery. The funeral service for Tina Siemens will be held Thursday, January 16th at 11am at Morris Nov 5, 2024 · Funeral For: Susan Rempel nee Derksen Funeral Date: November 8, 2024 Susan Rempel nee Derksen, 97, of Altona formerly of Edenburg, passed away Monday, November 4th at Eastview Place. A memorial service for Betty Harder will be held Friday, January 31st at 11am at Niverville Community Fellowship, 85 Second Street South. The funeral service for Viola Friesen nee Fuchs will be held Tuesday 3 days ago · Funeral For: Pastor Jake Harms Funeral Date: March 25, 2025 Pastor Jake Harms, 98, of Winnipeg passed away Wednesday, March 12th at Concordia Hospital. A private family graveside service for Helen Harder will be held at a Dec 10, 2024 · Funeral For: Laura Siemens Funeral Date: December 13, 2024 Laura Siemens, 94, of Morris formerly of Rosenort, passed away Friday, December 6th at Red River Valley Lodge. He was predeceased by 1 daughter. He is survived by 2 daughters, 1 son, 3 sisters, 3 brothers, and their families. The Mass of Resurrection service for Marcel Jan 18, 2025 · Funeral For: Heinrich Wiebe Funeral Date: January 22, 2025 Heinrich Wiebe, 86, of Altona formerly of Mexico passed away Thursday, January 16th at Altona Memorial Health Centre. She is survived by 3 grandsons and their families. The celebration of life for Zelma Fehr will be held Tuesday, October 22nd at 11am at Winkler Mennonite Church with private burial prior Jan 15, 2025 · Funeral For: Daniel Loewen Funeral Date: (postponed to January 18, 2025) Daniel Loewen, 88, of Steinbach passed away Friday, January 10th at Rest Haven Care Home. He is survived by 1 daughter, 1 son and their families. A celebration of life for Alvina Falk will be Nov 25, 2022 · Interment For: Victor Penner Interment Date: Private Victor Penner, 96, of Winnipeg formerly of Altona, passed away Tuesday, November 22nd at Brightwater Linden Pointe. Donations may be made to Cancer Care 1 day ago · Funeral For: Ronald F. She was predeceased by her father, 1 sister, and 2 brothers-in-law. She was predeceased by 3 children. She is survived by 3 daughters, 2 sons and their families. Hiebert. Wiens, 87, of Steinbach passed away Thursday, December 12th at Bethesda Regional Health Centre. She is survived by 1 daughter, 1 brother, and their families. She was predeceased by her husband John and 1 son. Arrangements by Wiebe Funeral Home, Winkler. He was predeceased by his parents Heinrich and Justa Pauls. He is survived by his wife Florence, 10 children and their families. The funeral service for Peter P. Funeral For: Vern Wieler Funeral Date: March 17, 2025 Vern Wieler, 65, of Plum Coulee formerly of Rosengart, passed away Thursday, February 27th at his residence. A private family memorial service for Bernhard “Ben” Falk will be held. He is survived by his wife Anne, 2 sisters, 1 daughter and their families. Wiens will be held Thursday, December 19th at 2pm at Birchwood Funeral Chapel with burial at Heritage Cemetery. He is survived by his wife Diane, 1 daughter, 2 sons, and their families. She is survived by her husband Abe, 2 sons, and their families. Reimer Funeral Date: February 2, 2024 Abram H. Viewing will Sep 11, 2021 · Funeral for: George Petkau Funeral Date: September 14, 2021 (Private) George Petkau, 99, of Winnipeg formerly of Elm Creek, passed away Monday, September 6th at Misercordia Health Care Center. She was predeceased by her husband Albert. He is survived by his wife Tina, 2 daughters, 5 sons, and their families. She was predeceased by her husband Ben H. She is survived by her husband Jacob, 4 sons, 1 sister, 3 brothers, and their families. The funeral service for Laura Siemens will be held Friday Oct 4, 2024 · Funeral For: Cameron Bartel Funeral Date: October 8, 2024 Cameron Bartel, 56, of Morris passed away Thursday, September 26th at Health Sciences Centre. She is survived by 1 daughter, 2 sons, and their families. Hoeppner, 91, of Winkler passed away Thursday, January 27th at Tabor Home. He is survived by his wife Debbie, 1 daughter, 2 sons, and their families. She was predeceased by her husband Peter, 1 son, and 1 sister. He is survived by 3 daughters, 2 sons, 1 sister and their families. A private funeral service for Peter Kauenhofen will take place. Private family interment will take place at Altona Cemetery. The funeral service for Cornelius Peters will be held Saturday, January 13th at 1:30pm at Altona United Church with burial at Gretna Cemetery. He is survived by his wife Petra Rahaman. He is survived by 4 daughters and their families. He was predeceased by 1 sister. A memorial service for Mary Fehr nee Dyck will be held Tuesday, February 13th at 11am at Altona EMMC with burial prior to the Aug 27, 2024 · Funeral For: Sheila Paulette Mary Campbell Funeral Date: August 28, 2024 Sheila Paulette Mary Campbell, 81, of Morden passed away Thursday, August 22nd at Boundary Trails Health Centre. A private funeral service for Mark Hamm will be held with video to follow. She was predeceased by her husband William, 1 sister, and 1 brother-in-law. A memorial service for Verna Hiebert nee Bergen will be held Thursday, 11am at Winkler Bergthaler Mennonite Church with Jan 29, 2025 · Funeral For: John Schulz Funeral Date: February 1, 2025 John Schulz, 95, of Elm Creek passed away Monday, January 27th at Carman Memorial Hospital. She was predeceased by her parents David and Maria Friesen and all of her siblings. A private family burial Dec 14, 2024 · Funeral For: Vern Wiens Funeral Date: December 22, 2024 Vern Wiens, 77, of Domain passed away Sunday, December 8th at Niverville Heritage Personal Care Home. Feb 15, 2025 · Celebration of Life For: Alvina Falk Celebration of Life date: February 20, 2025 Alvina Falk, 68, of Steinbach passed away Thursday, February 13th at Bethesda Hospital. She was predeceased by her mother Olga Enns. Abram will leave to mourn his beloved wife Lena; children Lidia, Linda (Brian), Irney (Chantel) and Amanda (Randal); grandchildren Tamairik (Jessica), Satiya, LeDainian, Jonas, Tobin, Daegan, Shayna, Roxton, Chella, Korbin and Ava; and great grandson Tazzin Jan 25, 2024 · Stanley Hildebrand Stan was unexpectedly called home on January 15, 2024 to join his Lord and Saviour. 11, 1944 – Nov. She is survived by sisters Wilma Unger and Valida Friesen. He is survived by his wife Ruth, 2 daughters, 2 sons, and their families. Arrangements by Friends Funeral Service, Winnipeg. Arrangements by Nov 17, 2024 · Funeral For: Verna Hiebert nee Bergen Funeral Date: November 21, 2024 Verna Hiebert nee Bergen, 100, of Winkler passed away Thursday, November 7th at Tabor Home. The funeral service for Willi Doerksen will be held Saturday Nov 2, 2021 · Private Funeral Service For: Mark Hamm Private Funeral Service Date: Private Mark Hamm, 47, of Winkler passed away Sunday, October 31st at Health Sciences Centre. The funeral service for Leona Enns will be held Wednesday, February 26th at 1pm at Birchwood Funeral Chapel with burial at Grunthal Funeral Announcements. 4, 2024 It is with heavy hearts that we announce the passing of Erica Sommer (née Martel) of Winnipeg, formerly of Rosenfeld and Altona, on November 4, 2024, after a short battle with cancer. Paul with Feb 1, 2024 · Funeral For: Ernest Enns Funeral Date: February 5, 2024 Ernest Enns, 77, of Winnipeg passed away Sunday, January 28th at Donwood Manor Personal Care Home. The funeral service for Abraham H. She is survived by her husband Cornie, 3 children, and 1 granddaughter. He was predeceased by 1 daughter and 2 sisters. The funeral service for James Lohr will be held Saturday, December 21st at 2pm at St Oct 21, 2023 · Funeral For: Henry Rempel Funeral Date: October 27, 2023 Henry Rempel, 99, of Winnipeg passed away Sunday, October 15th at Bethania Mennonite Personal Care Home. The funeral service for Henry Rempel will be held Monday, November 11th at 2pm at Mar 13, 2024 · Funeral For: Raj Raichura Funeral Date: Private Rajen (Raj) Diyaljibhai Raichura (82) peacefully passed away in his sleep in the early hours on March 3, 2024 at Bethesda Regional Health Centre (Manitoba, Canada). Jan 20, 2025 · A memorial service for Abram Abe Penner will be held Tuesday, January 21st at 2pm at Winkler Sommerfeld Mennonite Church with burial prior to the service at 1pm at Chortitz Community Cemetery. Funeral Announcements. She is survived by 4 daughters, 3 sons, 2 sisters, and their families. ← Previous . The funeral service for Ernest Enns will be held Monday, February 5th at 11am at Elmwood Mennonite Brethren Church Oct 18, 2024 · Funeral For: Zelma Fehr Funeral Date: October 22, 2024 Zelma Fehr, 89, of Winkler formerly of Kronsthal, passed away Thursday, October 17th at her residence. He is survived by 5 sisters, 2 brothers and their families. Reimer, 82, of Winnipeg passed away Sunday, January 28th at Winnipeg. He was predeceased by 2 great-grandchildren and 4 siblings. She was predeceased by her husband Lorne and 1 brother. He is survived by his former wife Agnes and their sons Ash (Nancy), Trevor (Yumi), and Jay (Emily), as well as six grandchildren. She was predeceased by her husband Lawrence and 1 grandson. Doerr Funeral Date: None yet Ronald F. Maria Mary Born nee Dyck. The funeral service for Minna Loewen will be held Monday, December 9th at 2pm at Birchwood Funeral Chapel with burial prior to the service at Heritage Cemetery. Viewing will be at Wiebe Funeral Home, Winkler Friday, January 3rd from 1 to 6pm and at the church prior to the service. He is survived by his wife Verna, 4 daughters, 1 son, and their families. She is survived by her husband Art, 1 daughter, 1 son, 6 grandchildren, and 1 sister. She is survived by her husband Raymond, 2 daughters, 1 son, and their families. He was predeceased by 1 grandchild, 2 sisters, and 3 brothers. He is survived by his wife Irene, 1 daughter, 2 sons, and their families. She is survived by her husband John, 3 sons, and her father Victor Enns. She is survived by 1 daughter, 1 son, 1 sister, 3 brothers, and their families. Enns Funeral Date: December 2, 2024 Abraham H. The funeral service for Daniel Loewen will be held Saturday Jan 2, 2025 · Funeral For: Henry Thiessen Funeral Date: January 4, 2025 Henry Thiessen, 85, of Grunthal formerly of Stuartburn, passed away Wednesday, January 1st at Menno Home. He also leaves to mourn, his siblings Sep 20, 2021 · Funeral For: Pedro “Peter” Fehr Funeral Date: September 22, 2021 Pedro “Peter” Fehr, 63, of Morden formerly of Winkler, passed away Saturday, September 18th at Health Sciences Centre. She is survived by 1 daughter, 5 sons, and 1 sister. The funeral service for Alice Ostrowsky will be held Wednesday, March 12th at 10:30am at Jan 14, 2025 · Funeral For: Tina Siemens Funeral Date: January 16, 2025 Tina Siemens, 89, of Morris formerly of Lowe Farm, passed away Saturday, January 11th at Red River Valley Lodge. Jan 28, 2025 · Funeral For: Mary Zacharias Funeral Date: January 31, 2025 Mary Zacharias, 88, of Winkler passed away Saturday, January 25th at De Salaberry District Health Centre. A memorial service for Helen Wolfe will be held Sunday, February 16th at 2pm at Winkler Sommerfeld Mennonite Jan 16, 2025 · Funeral For: Gerald Lemay Funeral Date: January 21, 2025 Gerald Lemay, 89, of La Broquerie passed away Monday, January 13th at Bethesda Regional Health Centre. She was predeceased by her husband Elvin. Arrangements by Birchwood Dec 16, 2024 · Funeral For: Peter P. liinlhplkullwfqhfrlgdlfhzchtudbzgbhnlxvanjbdwzqrfyramyvyylafnaqsrmseshmmqasff